PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039173
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 271aa    MW: 30342.9 Da    PI: 6.4073
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039173genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-152370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEde+l  ++++ G g+W+t +++ g+ R++k+c++rw +yl
      Lus10039173 23 RGPWTAEEDEILSGYINREGEGRWRTLPKRAGLLRCGKSCRLRWMNYL 70
                     89******************************99************97 PP

2Myb_DNA-binding506.6e-1676121148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg  T++E++l+++ +++lG++ W++Ia +++ gRt++++k++w+++l
      Lus10039173  76 RGHITPDEEDLILRMHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 121
                      6778******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3462070IPR017930Myb domain
SuperFamilySSF466893.74E-2821117IPR009057Homeodomain-like
SMARTSM007178.1E-112272IPR001005SANT/Myb domain
PfamPF002492.3E-132370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-212477IPR009057Homeodomain-like
CDDcd001672.27E-82570No hitNo description
PROSITE profilePS5129425.15671125IPR017930Myb domain
SMARTSM007172.9E-1575123IPR001005SANT/Myb domain
PfamPF002491.4E-1476121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-2578126IPR009057Homeodomain-like
CDDcd001671.23E-1180121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MRNPASSEQR TAAEAAKVGA IKRGPWTAEE DEILSGYINR EGEGRWRTLP KRAGLLRCGK  60
SCRLRWMNYL RPSVKRGHIT PDEEDLILRM HRLLGNRWSL IAGRIPGRTD NEIKNYWNTH  120
LSKKLISQGI DPTNHKPYIP SMINKPPPST SAKSSSSSLL LPTEPPSLRS KRCITYEHDQ  180
QQQAGDGALT HTMRNDIVVE RGEDDDEDYD HVGTTLDMMI ANNVDQVLKR EEEEDAAFSS  240
FLNSLINEEG DVYITNSTSA SSASPNPIDM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24231257108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434848.16e-89PREDICTED: transcription repressor MYB5-like
SwissprotQ388509e-82MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A0D2SPS87e-89A0A0D2SPS8_G
STRINGVIT_08s0007g07230.t013e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38943064
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.16e-78myb domain protein 5